PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41178.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 324aa    MW: 36796.9 Da    PI: 5.075
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41178.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.21.2e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ +v+++G  +W+  ++  g+ R++k+c++rw +yl
       KHN41178.1 14 KGTWTPEEDMKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYL 61
                     799*****************99************************97 PP

2Myb_DNA-binding56.18.5e-1867110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++E+e +++ +k+lG++ W++Ia +++ gRt++++k++w++
       KHN41178.1  67 RGNFTQQEEECIIRMHKKLGNR-WSAIAVELP-GRTDNEIKNHWHT 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.712961IPR017930Myb domain
SuperFamilySSF466892.77E-2911108IPR009057Homeodomain-like
SMARTSM007171.8E-91363IPR001005SANT/Myb domain
PfamPF002491.0E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-231568IPR009057Homeodomain-like
CDDcd001673.37E-91661No hitNo description
PROSITE profilePS5129426.2162116IPR017930Myb domain
SMARTSM007171.9E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1567110IPR001005SANT/Myb domain
CDDcd001671.26E-1169110No hitNo description
Gene3DG3DSA:1.10.10.608.4E-2569115IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MVRTPSCDKS GMRKGTWTPE EDMKLIAYVT RYGCWNWRQL PKFAGLARCG KSCRLRWMNY  60
LRPNIKRGNF TQQEEECIIR MHKKLGNRWS AIAVELPGRT DNEIKNHWHT ALKKRSQQNT  120
LINEETKAIK SKNKESVHNN GVFVTLPATS QISDNSSLSP VSSTCSEFSS ITSDLSTAAS  180
CMENLVFEDD DLGFLDLYNI DPMNGNLWTE LNLDGISFNT PCEIVSGDTN STFQSSSSSN  240
SNTLDSPHQS TSESIVVNND FGRFLDSYEE ATVDNFWTQS YVADMSHVPS ELFVPSVAES  300
EYFTPLYDDL WGQTHLYHEN HCLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-28141154104C-Myb DNA-Binding Domain
1msf_C1e-28141154104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358971e-60AC235897.2 Glycine max clone GM_WBc0123J08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526304.10.0PREDICTED: transcription factor WER-like
TrEMBLA0A0B2S8W80.0A0A0B2S8W8_GLYSO; Myb-related protein Myb4
TrEMBLK7KY780.0K7KY78_SOYBN; Uncharacterized protein
STRINGGLYMA06G45547.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.16e-60myb domain protein 14
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]